SCOPe 2.01: Domain d3bboo1: 3bbo O:7-130

Lineage for d3bboo1 (3bbo O:7-130)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [161281] (1 PDB entry)

8. Domain d3bboo1: 3bbo O:7-130 [155086]
   Other proteins in same PDB: d3bbo61, d3bboj1, d3bbok1, d3bbol1, d3bbou1, d3bbov1, d3bbox1
   automatically matched to d1njmk_

Details for d3bboo1

PDB Entry: 3bbo, 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome

PDB Compounds: (O:) ribosomal protein L16

SCOPe Domain Sequences for d3bboo1:

Sequence; same for both SEQRES and ATOM records:

>d3bboo1 i.1.1.2 (O:7-130) 50S subunit {Spinach (Spinacia oleracea) [TaxId: 3562]}
trfrkqhrgrmkgisyrgnricfgryalqalepawitsrqieagrramtrnarrggkiwv
rifpdkpvtvrpaetrmgsgkgspeywvavvkpgrilyeisgvaeniarravaiaaskmp
irtq

Timeline for d3bboo1:

• d3bboo1 first appeared in SCOP 1.75
  
• d3bboo1 appears in SCOPe 2.02
  
• d3bboo1 appears in the current release, SCOPe 2.08