Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries) |
Domain d3bbol1: 3bbo L:112-236 [155085] Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1 automatically matched to d1p85h_ |
PDB Entry: 3bbo (more details), 9.4 Å
SCOPe Domain Sequences for d3bbol1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbol1 i.1.1.1 (L:112-236) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kkwyvvdatdlilgrmastiaihirgknlasytpsvdmgafvivvnadkvavsgkkrtqk lyrrhsgrpgglkeetfdqlqkriperiiehavrgmlpkgrlgrylfnhlkvykgaehph qaqqp
Timeline for d3bbol1: