![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries) |
![]() | Domain d3bboj1: 3bbo J:51-118 [155083] Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1 automatically matched to d1p85f_ |
PDB Entry: 3bbo (more details), 9.4 Å
SCOPe Domain Sequences for d3bboj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bboj1 i.1.1.1 (J:51-118) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kvilkedvtdlgkqgqlldvkagffrnfllptgkaqlmtplllkelkmederieaekqrv keeaqqla
Timeline for d3bboj1: