Lineage for d3bbnq1 (3bbn Q:61-139)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070155Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)
  8. 1070157Domain d3bbnq1: 3bbn Q:61-139 [155078]
    automatically matched to d1eg0g_

Details for d3bbnq1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (Q:) ribosomal protein s17

SCOPe Domain Sequences for d3bbnq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnq1 i.1.1.1 (Q:61-139) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ktmqgrvvcatsdktvavevvrlaphpkykrrvrmkkkyqahdpdnqfkvgdvvrleksr
pisktksfvalpviaraar

SCOPe Domain Coordinates for d3bbnq1:

Click to download the PDB-style file with coordinates for d3bbnq1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnq1: