![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Mesembryanthemum crystallinum [TaxId:3544] [161277] (1 PDB entry) |
![]() | Domain d3bbnk1: 3bbn K:23-122 [155076] automatically matched to d1p6gk_ |
PDB Entry: 3bbn (more details), 9.4 Å
SCOPe Domain Sequences for d3bbnk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbnk1 i.1.1.1 (K:23-122) 70S ribosome functional complex {Mesembryanthemum crystallinum [TaxId: 3544]} rkipkgvihvqasfnntivtvtdvrgrvvswasagtcgfrgtkrgtpfaaqtaagnairt vveqgmqraevmikgpglgrdaalrairrsgillsfvrdv
Timeline for d3bbnk1: