Lineage for d3bbng1 (3bbn G:2-155)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896954Species Spinacia oleracea [TaxId:3562] [161276] (1 PDB entry)
  8. 896956Domain d3bbng1: 3bbn G:2-155 [155074]
    automatically matched to d1gixj_

Details for d3bbng1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (G:) ribosomal protein s7

SCOP Domain Sequences for d3bbng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbng1 i.1.1.1 (G:2-155) 70S ribosome functional complex {Spinacia oleracea [TaxId: 3562]}
srrgtveektaksdpiyrnrlvnmlvnrilkhgkkslayqilyravkkiqqktetnplsv
lrqairgvtpdiavkarrvggsthqvpieigstqgkalairwllgaarkrpgrnmafkls
selvdaakgsgdavrkkeethrmaeanrafahfr

SCOP Domain Coordinates for d3bbng1:

Click to download the PDB-style file with coordinates for d3bbng1.
(The format of our PDB-style files is described here.)

Timeline for d3bbng1: