Lineage for d3bbnb1 (3bbn B:10-233)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1468422Species Spinach (Spinacia oleracea) [TaxId:3562] [161276] (1 PDB entry)
  8. 1468423Domain d3bbnb1: 3bbn B:10-233 [155073]
    automatically matched to d1gixe_

Details for d3bbnb1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (B:) ribosomal protein s2

SCOPe Domain Sequences for d3bbnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnb1 i.1.1.1 (B:10-233) 70S ribosome functional complex {Spinach (Spinacia oleracea) [TaxId: 3562]}
leemmeagvhfghgtrkwnprmspyisakckgihiinltrtarflseacdlvfdassrgk
qflivgtknkaadsvaraairarchyvnkkwlggmltnwsttetrlhkfrdlrmeqtagr
larlpkrdaavvkrqlshlqtylggikymtglpdiviivdqqeeytalrecitlgiptic
lidtncnpdladisipanddaiasirliltklvfaicegrssyi

SCOPe Domain Coordinates for d3bbnb1:

Click to download the PDB-style file with coordinates for d3bbnb1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnb1: