SCOPe 2.05: Domain d3baya1: 3bay A:409-496

Lineage for d3baya1 (3bay A:409-496)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (49 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d3baya1: 3bay A:409-496 [155043]
   Other proteins in same PDB: d3baya2
   automated match to d1jxka1
   complexed with are, ca, nag, no3

Details for d3baya1

PDB Entry: 3bay, 1.99 Å

PDB Description: n298s variant of human pancreatic alpha-amylase in complex with nitrate and acarbose

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3baya1:

Sequence; same for both SEQRES and ATOM records:

>d3baya1 b.71.1.1 (A:409-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d3baya1:

• d3baya1 first appeared in SCOP 1.75
  
• d3baya1 appears in SCOPe 2.04
  
• d3baya1 appears in SCOPe 2.06
  
• d3baya1 appears in the current release, SCOPe 2.08