Lineage for d3bara1 (3bar A:1-321)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814562Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 814566Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (7 PDB entries)
  8. 814569Domain d3bara1: 3bar A:1-321 [155036]
    automatically matched to d2f84a1
    complexed with u5p

Details for d3bara1

PDB Entry: 3bar (more details), 1.9 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-phosphate decarboxylase covalently modified by 6-azido-UMP
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d3bara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bara1 c.1.2.3 (A:1-321) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnm

SCOP Domain Coordinates for d3bara1:

Click to download the PDB-style file with coordinates for d3bara1.
(The format of our PDB-style files is described here.)

Timeline for d3bara1: