SCOPe 2.08: Domain d3b9rb2: 3b9r B:344-360,B:600-750

Lineage for d3b9rb2 (3b9r B:344-360,B:600-750)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (42 PDB entries)
   Uniprot P04191

8. Domain d3b9rb2: 3b9r B:344-360,B:600-750 [155019]
   Other proteins in same PDB: d3b9ra1, d3b9ra3, d3b9ra4, d3b9rb1, d3b9rb3, d3b9rb4
   automatically matched to d1iwoa2
   complexed with acp, alf, k, mg

Details for d3b9rb2

PDB Entry: 3b9r, 3 Å

PDB Description: SERCA Ca2+-ATPase E2 aluminium fluoride complex without thapsigargin

PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3b9rb2:

Sequence; same for both SEQRES and ATOM records:

>d3b9rb2 c.108.1.7 (B:344-360,B:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d3b9rb2:

• d3b9rb2 first appeared in SCOP 1.75
  
• d3b9rb2 appears in SCOPe 2.07