SCOP 1.75: Domain d3b7ux2: 3b7u X:1-208

Lineage for d3b7ux2 (3b7u X:1-208)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family)

5. Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (15 PDB entries)
   Uniprot P09960

8. Domain d3b7ux2: 3b7u X:1-208 [154947]
   Other proteins in same PDB: d3b7ux1, d3b7ux3
   automatically matched to d1gw6a2
   complexed with acy, imd, kel, yb, zn

Details for d3b7ux2

PDB Entry: 3b7u, 1.9 Å

PDB Description: leukotriene a4 hydrolase complexed with kelatorphan

PDB Compounds: (X:) Leukotriene A-4 hydrolase

SCOP Domain Sequences for d3b7ux2:

Sequence; same for both SEQRES and ATOM records:

>d3b7ux2 b.98.1.1 (X:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

Timeline for d3b7ux2:

• d3b7ux2 is new in SCOP 1.75
  
• d3b7ux2 appears in SCOPe 2.01
  
• d3b7ux2 appears in the current release, SCOPe 2.08