SCOPe 2.01: Domain d3b71c_: 3b71 C:

Lineage for d3b71c_ (3b71 C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)

6. Protein automated matches [190364] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187198] (1 PDB entry)

8. Domain d3b71c_: 3b71 C: [154914]
   automated match to d1k04a_

Details for d3b71c_

PDB Entry: 3b71, 2.82 Å

PDB Description: CD4 endocytosis motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase

PDB Compounds: (C:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3b71c_:

Sequence; same for both SEQRES and ATOM records:

>d3b71c_ a.24.14.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatv
detipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahala
vdaknlldvidqarlkmlg

Timeline for d3b71c_:

• d3b71c_ first appeared in SCOP 1.75, called d3b71c1
  
• d3b71c_ appears in SCOPe 2.02
  
• d3b71c_ appears in the current release, SCOPe 2.08