Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) |
Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins) |
Protein automated matches [190364] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187198] (1 PDB entry) |
Domain d3b71c_: 3b71 C: [154914] automated match to d1k04a_ |
PDB Entry: 3b71 (more details), 2.82 Å
SCOPe Domain Sequences for d3b71c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b71c_ a.24.14.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} isppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatv detipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahala vdaknlldvidqarlkmlg
Timeline for d3b71c_: