Lineage for d3b71a1 (3b71 A:916-1049)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765756Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 765757Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 765758Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 765763Species Human (Homo sapiens) [TaxId:9606] [68996] (7 PDB entries)
  8. 765778Domain d3b71a1: 3b71 A:916-1049 [154912]
    automatically matched to d1k04a_

Details for d3b71a1

PDB Entry: 3b71 (more details), 2.82 Å

PDB Description: CD4 endocytosis motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d3b71a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b71a1 a.24.14.1 (A:916-1049) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
nldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipll
pasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknll
dvidqarlkmlgqt

SCOP Domain Coordinates for d3b71a1:

Click to download the PDB-style file with coordinates for d3b71a1.
(The format of our PDB-style files is described here.)

Timeline for d3b71a1: