Lineage for d3b6sa2 (3b6s A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021081Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
    Uniprot P30481 25-300
  8. 1021085Domain d3b6sa2: 3b6s A:1-181 [154910]
    Other proteins in same PDB: d3b6sa1, d3b6sb_
    automatically matched to d1m6oa2

Details for d3b6sa2

PDB Entry: 3b6s (more details), 1.8 Å

PDB Description: crystal structure of hla-b*2705 complexed with the citrullinated vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d3b6sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6sa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d3b6sa2:

Click to download the PDB-style file with coordinates for d3b6sa2.
(The format of our PDB-style files is described here.)

Timeline for d3b6sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b6sa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3b6sb_