Lineage for d3b6oc1 (3b6o C:9-234)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837260Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)
  7. 837261Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
    Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234
  8. 837264Domain d3b6oc1: 3b6o C:9-234 [154903]
    automatically matched to 2O4G A:9-234
    complexed with li, tmp

Details for d3b6oc1

PDB Entry: 3b6o (more details), 2.1 Å

PDB Description: Structure of TREX1 in complex with a nucleotide and an inhibitor ion (lithium)
PDB Compounds: (C:) Three prime repair exonuclease 1

SCOP Domain Sequences for d3b6oc1:

Sequence, based on SEQRES records: (download)

>d3b6oc1 c.55.3.5 (C:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d3b6oc1 c.55.3.5 (C:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOP Domain Coordinates for d3b6oc1:

Click to download the PDB-style file with coordinates for d3b6oc1.
(The format of our PDB-style files is described here.)

Timeline for d3b6oc1: