SCOP 1.75: Domain d3b6da2: 3b6d A:319-450

Lineage for d3b6da2 (3b6d A:319-450)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (3 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (13 PDB entries)

8. Domain d3b6da2: 3b6d A:319-450 [154883]
   Other proteins in same PDB: d3b6da1
   automatically matched to d1b8sa2
   complexed with fae, so4; mutant

Details for d3b6da2

PDB Entry: 3b6d, 1.2 Å

PDB Description: crystal structure of streptomyces cholesterol oxidase h447q/e361q mutant (1.2a)

PDB Compounds: (A:) cholesterol oxidase

SCOP Domain Sequences for d3b6da2:

Sequence; same for both SEQRES and ATOM records:

>d3b6da2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyqplg

Timeline for d3b6da2:

• d3b6da2 is new in SCOP 1.75
  
• d3b6da2 appears in SCOPe 2.01
  
• d3b6da2 appears in the current release, SCOPe 2.08