Lineage for d3b5ra1 (3b5r A:671-917)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776485Protein Androgen receptor [63621] (3 species)
  7. 776495Species Human (Homo sapiens) [TaxId:9606] [63623] (36 PDB entries)
    Uniprot P10275 671-919
  8. 776506Domain d3b5ra1: 3b5r A:671-917 [154851]
    automatically matched to d1e3ga_
    complexed with b5r

Details for d3b5ra1

PDB Entry: 3b5r (more details), 1.8 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with SARM C-31
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d3b5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5ra1 a.123.1.1 (A:671-917) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfh

SCOP Domain Coordinates for d3b5ra1:

Click to download the PDB-style file with coordinates for d3b5ra1.
(The format of our PDB-style files is described here.)

Timeline for d3b5ra1: