Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (1 family) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (11 proteins) |
Protein Synaptobrevin [88903] (3 species) |
Species Saccharomyces cerevisiae [TaxId:4932] [161253] (1 PDB entry) |
Domain d3b5na1: 3b5n A:28-86 [154846] Other proteins in same PDB: d3b5nb1, d3b5nc1, d3b5nf1, d3b5nj1 automatically matched to d1sfca_ |
PDB Entry: 3b5n (more details), 1.6 Å
SCOP Domain Sequences for d3b5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5na1 h.1.15.1 (A:28-86) Synaptobrevin {Saccharomyces cerevisiae [TaxId: 4932]} rtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkamw
Timeline for d3b5na1:
View in 3D Domains from other chains: (mouse over for more information) d3b5nb1, d3b5nc1, d3b5nf1, d3b5nj1 |