SCOPe 2.06: Domain d6hbwd_: 6hbw D:

Lineage for d6hbwd_ (6hbw D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (245 PDB entries)
   Uniprot P68871

8. Domain d6hbwd_: 6hbw D: [15484]
   Other proteins in same PDB: d6hbwa_, d6hbwc_
   complexed with hem

Details for d6hbwd_

PDB Entry: 6hbw, 2 Å

PDB Description: crystal structure of deoxy-human hemoglobin beta6 glu->trp

PDB Compounds: (D:) protein (hemoglobin beta)

SCOPe Domain Sequences for d6hbwd_:

Sequence; same for both SEQRES and ATOM records:

>d6hbwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpweksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d6hbwd_:

• d6hbwd_ first appeared (with stable ids) in SCOP 1.55
  
• d6hbwd_ appears in SCOPe 2.05
  
• d6hbwd_ appears in SCOPe 2.07
  
• d6hbwd_ appears in the current release, SCOPe 2.08