Lineage for d6hbwb_ (6hbw B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531278Domain d6hbwb_: 6hbw B: [15483]
    Other proteins in same PDB: d6hbwa_, d6hbwc_

Details for d6hbwb_

PDB Entry: 6hbw (more details), 2 Å

PDB Description: Crystal structure of deoxy-human hemoglobin beta6 glu->trp

SCOP Domain Sequences for d6hbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hbwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpweksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d6hbwb_:

Click to download the PDB-style file with coordinates for d6hbwb_.
(The format of our PDB-style files is described here.)

Timeline for d6hbwb_: