Lineage for d1a0zb_ (1a0z B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349705Protein Hemoglobin, beta-chain [46500] (19 species)
  7. 349759Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries)
  8. 349876Domain d1a0zb_: 1a0z B: [15481]
    Other proteins in same PDB: d1a0za_, d1a0zc_

Details for d1a0zb_

PDB Entry: 1a0z (more details), 2 Å

PDB Description: hemoglobin (val beta1 met) mutant

SCOP Domain Sequences for d1a0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0zb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1a0zb_:

Click to download the PDB-style file with coordinates for d1a0zb_.
(The format of our PDB-style files is described here.)

Timeline for d1a0zb_: