Lineage for d3b3ia2 (3b3i A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544944Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
    Uniprot P03989 25-300
  8. 2544954Domain d3b3ia2: 3b3i A:1-181 [154807]
    Other proteins in same PDB: d3b3ia1, d3b3ib2, d3b3ib3
    automated match to d1k5na2
    complexed with gol

Details for d3b3ia2

PDB Entry: 3b3i (more details), 1.86 Å

PDB Description: citrullination-dependent differential presentation of a self-peptide by hla-b27 subtypes
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d3b3ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3ia2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d3b3ia2:

Click to download the PDB-style file with coordinates for d3b3ia2.
(The format of our PDB-style files is described here.)

Timeline for d3b3ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b3ia1