Lineage for d3b32a1 (3b32 A:3-75)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087980Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1088032Protein Calmodulin [47516] (11 species)
  7. 1088236Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (6 PDB entries)
  8. 1088238Domain d3b32a1: 3b32 A:3-75 [154805]
    automatically matched to d1ak8a_
    complexed with ca

Details for d3b32a1

PDB Entry: 3b32 (more details), 1.6 Å

PDB Description: Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d3b32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b32a1 a.39.1.5 (A:3-75) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d3b32a1:

Click to download the PDB-style file with coordinates for d3b32a1.
(The format of our PDB-style files is described here.)

Timeline for d3b32a1: