Lineage for d3b2us1 (3b2u S:311-480)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111641Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2111642Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2111643Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2111651Domain d3b2us1: 3b2u S:311-480 [154794]
    Other proteins in same PDB: d3b2ua2, d3b2ua3, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2
    automated match to d4krla1
    complexed with nag, so4

Details for d3b2us1

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (S:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3b2us1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2us1 c.10.2.5 (S:311-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d3b2us1:

Click to download the PDB-style file with coordinates for d3b2us1.
(The format of our PDB-style files is described here.)

Timeline for d3b2us1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2