![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
![]() | Protein EGF receptor extracellular domain [82326] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries) |
![]() | Domain d3b2up1: 3b2u P:310-480 [154790] Other proteins in same PDB: d3b2ua2, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue2, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui2, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um2, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up2, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv2, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2 automated match to d4krla1 complexed with nag, so4 |
PDB Entry: 3b2u (more details), 2.58 Å
SCOPe Domain Sequences for d3b2up1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2up1 c.10.2.5 (P:310-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d3b2up1:
![]() Domains from other chains: (mouse over for more information) d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2 |