Lineage for d2hbsd_ (2hbs D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632381Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)
  8. 632521Domain d2hbsd_: 2hbs D: [15478]
    Other proteins in same PDB: d2hbsa_, d2hbsc_, d2hbse_, d2hbsg_

Details for d2hbsd_

PDB Entry: 2hbs (more details), 2.05 Å

PDB Description: the high resolution crystal structure of deoxyhemoglobin s
PDB Compounds: (D:) hemoglobin s

SCOP Domain Sequences for d2hbsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbsd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d2hbsd_:

Click to download the PDB-style file with coordinates for d2hbsd_.
(The format of our PDB-style files is described here.)

Timeline for d2hbsd_: