Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) |
Domain d3b2uc1: 3b2u C:1-121 [154774] Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uw2, d3b2ux1, d3b2ux2 automatically matched to d1deeb1 complexed with nag, so4 |
PDB Entry: 3b2u (more details), 2.58 Å
SCOPe Domain Sequences for d3b2uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2uc1 b.1.1.1 (C:1-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs s
Timeline for d3b2uc1:
View in 3D Domains from other chains: (mouse over for more information) d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2 |