Lineage for d3b2rb1 (3b2r B:538-860)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780402Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 780403Species Human (Homo sapiens) [TaxId:9606] [101440] (15 PDB entries)
    Uniprot O76074 534-860
  8. 780414Domain d3b2rb1: 3b2r B:538-860 [154769]
    automatically matched to d1t9ra_
    complexed with vdn

Details for d3b2rb1

PDB Entry: 3b2r (more details), 2.07 Å

PDB Description: Crystal Structure of PDE5A1 catalytic domain in complex with Vardenafil
PDB Compounds: (B:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOP Domain Sequences for d3b2rb1:

Sequence, based on SEQRES records: (download)

>d3b2rb1 a.211.1.2 (B:538-860) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr
wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh
rgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkiik
qailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqr
iaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvse
dcfplldgcrknrqkwqalaeqq

Sequence, based on observed residues (ATOM records): (download)

>d3b2rb1 a.211.1.2 (B:538-860) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr
wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh
rgchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikrrge
ffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqkknki
psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq

SCOP Domain Coordinates for d3b2rb1:

Click to download the PDB-style file with coordinates for d3b2rb1.
(The format of our PDB-style files is described here.)

Timeline for d3b2rb1: