SCOPe 2.04: Domain d2zpya3: 2zpy A:3-87

Lineage for d2zpya3 (2zpy A:3-87)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.4: First domain of FERM [54256] (6 proteins)

6. Protein Radixin [54259] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)

8. Domain d2zpya3: 2zpy A:3-87 [154760]
   Other proteins in same PDB: d2zpya1, d2zpya2
   automatically matched to d1gc6a3

Details for d2zpya3

PDB Entry: 2zpy, 2.1 Å

PDB Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide

PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2zpya3:

Sequence; same for both SEQRES and ATOM records:

>d2zpya3 d.15.1.4 (A:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

Timeline for d2zpya3:

• d2zpya3 first appeared in SCOP 1.75
  
• d2zpya3 appears in SCOPe 2.03
  
• d2zpya3 appears in SCOPe 2.05
  
• d2zpya3 appears in the current release, SCOPe 2.08