Lineage for d2zp0t1 (2zp0 T:6-108)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521340Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1521341Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
    Uniprot P13726 33-242
  8. 1521389Domain d2zp0t1: 2zp0 T:6-108 [154748]
    Other proteins in same PDB: d2zp0h_, d2zp0l1, d2zp0l2, d2zp0l3
    automatically matched to d1a21a1
    complexed with bgc, ca, fuc, pi0

Details for d2zp0t1

PDB Entry: 2zp0 (more details), 2.7 Å

PDB Description: human factor viia-tissue factor complexed with benzylsulfonamide-d- ile-gln-p-aminobenzamidine
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2zp0t1:

Sequence, based on SEQRES records: (download)

>d2zp0t1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d2zp0t1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

SCOPe Domain Coordinates for d2zp0t1:

Click to download the PDB-style file with coordinates for d2zp0t1.
(The format of our PDB-style files is described here.)

Timeline for d2zp0t1: