SCOPe 2.05: Domain d2zp0l2: 2zp0 L:87-142

Lineage for d2zp0l2 (2zp0 L:87-142)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d2zp0l2: 2zp0 L:87-142 [154746]
   Other proteins in same PDB: d2zp0h_, d2zp0l3, d2zp0t1, d2zp0t2
   automated match to d1danl2
   complexed with bgc, ca, fuc, pi0

Details for d2zp0l2

PDB Entry: 2zp0, 2.7 Å

PDB Description: human factor viia-tissue factor complexed with benzylsulfonamide-d- ile-gln-p-aminobenzamidine

PDB Compounds: (L:) Factor VII light chain

SCOPe Domain Sequences for d2zp0l2:

Sequence; same for both SEQRES and ATOM records:

>d2zp0l2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2zp0l2:

• d2zp0l2 first appeared in SCOP 1.75
  
• d2zp0l2 appears in SCOPe 2.04
  
• d2zp0l2 appears in SCOPe 2.06
  
• d2zp0l2 appears in the current release, SCOPe 2.08