Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
Protein Transcriptional regulator Cgl2612 [140895] (1 species) |
Species Corynebacterium glutamicum [TaxId:1718] [140896] (2 PDB entries) Uniprot Q8NMG3 75-175 |
Domain d2zoza2: 2zoz A:74-174 [154741] Other proteins in same PDB: d2zoza1, d2zozb1 complexed with et, gol, so4 |
PDB Entry: 2zoz (more details), 1.95 Å
SCOP Domain Sequences for d2zoza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zoza2 a.121.1.1 (A:74-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} pedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahk ravylvqlaadglfvhdyihddvlskskrqamletilelip
Timeline for d2zoza2: