Lineage for d2zoza2 (2zoz A:74-174)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776253Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 776254Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 776255Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 776456Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 776457Species Corynebacterium glutamicum [TaxId:1718] [140896] (2 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 776460Domain d2zoza2: 2zoz A:74-174 [154741]
    Other proteins in same PDB: d2zoza1, d2zozb1
    complexed with et, gol, so4

Details for d2zoza2

PDB Entry: 2zoz (more details), 1.95 Å

PDB Description: Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor CgmR
PDB Compounds: (A:) Transcriptional regulator

SCOP Domain Sequences for d2zoza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoza2 a.121.1.1 (A:74-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
pedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahk
ravylvqlaadglfvhdyihddvlskskrqamletilelip

SCOP Domain Coordinates for d2zoza2:

Click to download the PDB-style file with coordinates for d2zoza2.
(The format of our PDB-style files is described here.)

Timeline for d2zoza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zoza1