SCOPe 2.01: Domain d2zolb_: 2zol B:

Lineage for d2zolb_ (2zol B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
   Uniprot P01887

8. Domain d2zolb_: 2zol B: [154736]
   Other proteins in same PDB: d2zola1, d2zola2, d2zolc1, d2zolc2
   automated match to d1bz9b_
   complexed with so4

Details for d2zolb_

PDB Entry: 2zol, 2.7 Å

PDB Description: crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zolb_:

Sequence; same for both SEQRES and ATOM records:

>d2zolb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2zolb_:

• d2zolb_ first appeared in SCOP 1.75, called d2zolb1
  
• d2zolb_ appears in SCOPe 2.02
  
• d2zolb_ appears in the current release, SCOPe 2.08