Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
Domain d2zola1: 2zol A:182-274 [154734] Other proteins in same PDB: d2zola2, d2zolb1, d2zolc2, d2zold1 automatically matched to d1ddha1 complexed with aba, so4; mutant |
PDB Entry: 2zol (more details), 2.7 Å
SCOP Domain Sequences for d2zola1:
Sequence, based on SEQRES records: (download)
>d2zola1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
>d2zola1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvpl qnytcrvyheglpepltlrw
Timeline for d2zola1:
View in 3D Domains from other chains: (mouse over for more information) d2zolb1, d2zolc1, d2zolc2, d2zold1 |