Lineage for d2zokg2 (2zok G:3-180)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856608Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 856619Domain d2zokg2: 2zok G:3-180 [154732]
    Other proteins in same PDB: d2zoka1, d2zokb1, d2zokc1, d2zokd1, d2zoke1, d2zokf1, d2zokg1, d2zokh1
    automatically matched to d1ddha2
    complexed with aba, gol, so4

Details for d2zokg2

PDB Entry: 2zok (more details), 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d2zokg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zokg2 d.19.1.1 (G:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOP Domain Coordinates for d2zokg2:

Click to download the PDB-style file with coordinates for d2zokg2.
(The format of our PDB-style files is described here.)

Timeline for d2zokg2: