SCOP 1.75: Domain d2zoke2: 2zok E:3-180

Lineage for d2zoke2 (2zok E:3-180)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)

8. Domain d2zoke2: 2zok E:3-180 [154729]
   Other proteins in same PDB: d2zoka1, d2zokb1, d2zokc1, d2zokd1, d2zoke1, d2zokf1, d2zokg1, d2zokh1
   automatically matched to d1ddha2
   complexed with aba, gol, so4

Details for d2zoke2

PDB Entry: 2zok, 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510

PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d2zoke2:

Sequence; same for both SEQRES and ATOM records:

>d2zoke2 d.19.1.1 (E:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d2zoke2:

• d2zoke2 is new in SCOP 1.75
  
• d2zoke2 appears in SCOPe 2.01
  
• d2zoke2 appears in the current release, SCOPe 2.08