Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries) |
Domain d2znve_: 2znv E: [154709] Other proteins in same PDB: d2znva_, d2znvc_, d2znvd_, d2znvf_ automated match to d1aara_ complexed with edo, zn |
PDB Entry: 2znv (more details), 1.6 Å
SCOPe Domain Sequences for d2znve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znve_ d.15.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqrestlhlvlrlrgg
Timeline for d2znve_: