Lineage for d2znve_ (2znv E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893246Protein automated matches [190118] (9 species)
    not a true protein
  7. 1893432Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries)
  8. 1893434Domain d2znve_: 2znv E: [154709]
    Other proteins in same PDB: d2znva_, d2znvc_, d2znvd_, d2znvf_
    automated match to d1aara_
    complexed with edo, zn

Details for d2znve_

PDB Entry: 2znv (more details), 1.6 Å

PDB Description: crystal structure of human amsh-lp dub domain in complex with lys63- linked ubiquitin dimer
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d2znve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znve_ d.15.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d2znve_:

Click to download the PDB-style file with coordinates for d2znve_.
(The format of our PDB-style files is described here.)

Timeline for d2znve_: