![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (17 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries) |
![]() | Domain d2znvb_: 2znv B: [154707] Other proteins in same PDB: d2znva_, d2znvc_, d2znvd_, d2znvf_ automated match to d1aara_ complexed with edo, zn |
PDB Entry: 2znv (more details), 1.6 Å
SCOPe Domain Sequences for d2znvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znvb_ d.15.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqrestlhlvlrlrgg
Timeline for d2znvb_: