SCOP 1.75: Domain d2zm4a1: 2zm4 A:231-498

Lineage for d2zm4a1 (2zm4 A:231-498)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (17 PDB entries)

8. Domain d2zm4a1: 2zm4 A:231-498 [154688]
   automatically matched to d1qpca_
   complexed with dms, ksm, so4

Details for d2zm4a1

PDB Entry: 2zm4, 2.7 Å

PDB Description: Crystal structure of imidazo quinoxaline 1 bound to the kinase domain of human LCK, activated form (auto-phosphorylated on TYR394)

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOP Domain Sequences for d2zm4a1:

Sequence; same for both SEQRES and ATOM records:

>d2zm4a1 d.144.1.7 (A:231-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledff

Timeline for d2zm4a1:

• d2zm4a1 is new in SCOP 1.75
  
• d2zm4a1 is called d2zm4a_ in SCOPe 2.01
  
• d2zm4a1 appears in the current release, SCOPe 2.08, called d2zm4a_