Lineage for d2zlwb1 (2zlw B:1-145)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759082Species Horse (Equus caballus) [TaxId:9796] [46504] (14 PDB entries)
  8. 759099Domain d2zlwb1: 2zlw B:1-145 [154675]
    Other proteins in same PDB: d2zlwa1, d2zlwc1
    automatically matched to d1g0bb_
    complexed with hem

Details for d2zlwb1

PDB Entry: 2zlw (more details), 2.9 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (75% relative humidity)
PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2zlwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlwb1 a.1.1.2 (B:1-145) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahky

SCOP Domain Coordinates for d2zlwb1:

Click to download the PDB-style file with coordinates for d2zlwb1.
(The format of our PDB-style files is described here.)

Timeline for d2zlwb1: