Lineage for d2zlvb_ (2zlv B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474002Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1474095Species Horse (Equus caballus) [TaxId:9796] [46504] (16 PDB entries)
  8. 1474104Domain d2zlvb_: 2zlv B: [154673]
    Other proteins in same PDB: d2zlva_
    automated match to d1g0bb_
    complexed with hem

Details for d2zlvb_

PDB Entry: 2zlv (more details), 2 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (79% relative humidity)
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zlvb_:

Sequence, based on SEQRES records: (download)

>d2zlvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Sequence, based on observed residues (ATOM records): (download)

>d2zlvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffnpkvkahgkkvlhsfgeg
vhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgkdftpelqasyqkvv
agvanalahkyh

SCOPe Domain Coordinates for d2zlvb_:

Click to download the PDB-style file with coordinates for d2zlvb_.
(The format of our PDB-style files is described here.)

Timeline for d2zlvb_: