SCOP 1.75: Domain d2zlvb1: 2zlv B:1-145

Lineage for d2zlvb1 (2zlv B:1-145)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (14 PDB entries)

8. Domain d2zlvb1: 2zlv B:1-145 [154673]
   Other proteins in same PDB: d2zlva1
   automatically matched to d1g0bb_
   complexed with hem

Details for d2zlvb1

PDB Entry: 2zlv, 2 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (79% relative humidity)

PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2zlvb1:

Sequence, based on SEQRES records:

>d2zlvb1 a.1.1.2 (B:1-145) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahky

Sequence, based on observed residues (ATOM records):

>d2zlvb1 a.1.1.2 (B:1-145) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffnpkvkahgkkvlhsfgeg
vhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgkdftpelqasyqkvv
agvanalahky

Timeline for d2zlvb1:

• d2zlvb1 is new in SCOP 1.75
  
• d2zlvb1 is called d2zlvb_ in SCOPe 2.01
  
• d2zlvb1 appears in the current release, SCOPe 2.08, called d2zlvb_