Lineage for d2zlta_ (2zlt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976866Species Horse (Equus caballus) [TaxId:9796] [46488] (17 PDB entries)
  8. 1976873Domain d2zlta_: 2zlt A: [154668]
    Other proteins in same PDB: d2zltb_
    automated match to d1g0ba_
    complexed with hem

Details for d2zlta_

PDB Entry: 2zlt (more details), 1.9 Å

PDB Description: Horse methemoglobin high salt, pH 7.0
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2zlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlta_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d2zlta_:

Click to download the PDB-style file with coordinates for d2zlta_.
(The format of our PDB-style files is described here.)

Timeline for d2zlta_: