Lineage for d2zl8b2 (2zl8 B:9-96)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855404Species Arthrobacter globiformis [TaxId:1665] [54421] (39 PDB entries)
    Uniprot P46881 9-628
  8. 855449Domain d2zl8b2: 2zl8 B:9-96 [154624]
    Other proteins in same PDB: d2zl8a1, d2zl8b1
    automatically matched to d1av4a2
    complexed with cu, esb

Details for d2zl8b2

PDB Entry: 2zl8 (more details), 1.73 Å

PDB Description: Crystal structure of copper amine oxidase from Arthrobacter globiformis: Substrate Schiff-base intermediate formed with ethylamine
PDB Compounds: (B:) phenylethylamine oxidase

SCOP Domain Sequences for d2zl8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zl8b2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d2zl8b2:

Click to download the PDB-style file with coordinates for d2zl8b2.
(The format of our PDB-style files is described here.)

Timeline for d2zl8b2: