Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries) |
Domain d2zkrx1: 2zkr x:22-96 [154617] Other proteins in same PDB: d2zkrv1 automatically matched to d1s1iw_ |
PDB Entry: 2zkr (more details), 8.7 Å
SCOP Domain Sequences for d2zkrx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkrx1 i.1.1.1 (x:22-96) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]} treytinihkrihgvgfkkrapralkeirkfamkemgtpdvridtrlnkavwakgirnvp yrirvrlsrkrnede
Timeline for d2zkrx1: