Lineage for d2zkro1 (2zkr o:21-138)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1467839Species Dog (Canis familiaris) [TaxId:9615] [161275] (2 PDB entries)
  8. 1467859Domain d2zkro1: 2zkr o:21-138 [154611]
    Other proteins in same PDB: d2zkrv1
    automatically matched to d1s1io_
    protein/RNA complex

Details for d2zkro1

PDB Entry: 2zkr (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 60S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (o:) 60S Ribosomal protein L18

SCOPe Domain Sequences for d2zkro1:

Sequence, based on SEQRES records: (download)

>d2zkro1 i.1.1.1 (o:21-138) 70S ribosome functional complex {Dog (Canis familiaris) [TaxId: 9615]}
diylrllvklyrflarrtnstfnqvvlkrlfmsrtnrpplslsrmirkmklpgrenktav
vvgtvtddvrilevpklkvcalrvssrarsrilkaggkiltfdqlalespkgrgtvll

Sequence, based on observed residues (ATOM records): (download)

>d2zkro1 i.1.1.1 (o:21-138) 70S ribosome functional complex {Dog (Canis familiaris) [TaxId: 9615]}
diylrllvklyrflarrnstfnqvvlkrlfmsrtnrpplslsrmirkmklpgrenktavv
vgtvtddvrilevpklkvcalrvssrarsrilkaggkiltfdqlalespkgrgtvll

SCOPe Domain Coordinates for d2zkro1:

Click to download the PDB-style file with coordinates for d2zkro1.
(The format of our PDB-style files is described here.)

Timeline for d2zkro1: