Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
Domain d2zkqo1: 2zkq o:1-85 [154600] Other proteins in same PDB: d2zkqc1 automatically matched to d1eg0f_ |
PDB Entry: 2zkq (more details), 8.7 Å
SCOP Domain Sequences for d2zkqo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkqo1 i.1.1.1 (o:1-85) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklg
Timeline for d2zkqo1: