Lineage for d2zkqo1 (2zkq o:1-85)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897057Domain d2zkqo1: 2zkq o:1-85 [154600]
    Other proteins in same PDB: d2zkqc1
    automatically matched to d1eg0f_

Details for d2zkqo1

PDB Entry: 2zkq (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 40S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (o:) 40S Ribosomal protein S13e

SCOP Domain Sequences for d2zkqo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkqo1 i.1.1.1 (o:1-85) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklg

SCOP Domain Coordinates for d2zkqo1:

Click to download the PDB-style file with coordinates for d2zkqo1.
(The format of our PDB-style files is described here.)

Timeline for d2zkqo1: