Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Canis lupus familiaris [TaxId:9615] [161275] (2 PDB entries) |
Domain d2zkql1: 2zkq l:27-140 [154597] Other proteins in same PDB: d2zkqc1 automatically matched to d1s1hl_ protein/RNA complex |
PDB Entry: 2zkq (more details), 8.7 Å
SCOPe Domain Sequences for d2zkql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkql1 i.1.1.1 (l:27-140) 70S ribosome functional complex {Canis lupus familiaris [TaxId: 9615]} ykkahlgtalkanpfggashakgivlekvgveakqpnsairkcvrvqlikngkkitafvp ndgclnfieendevlvagfgrkghavgdipgvrfkvvkvanvsllalykgkker
Timeline for d2zkql1: