Lineage for d2zkdb_ (2zkd B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1142195Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1142196Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1142402Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 1142403Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 1142412Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 1142416Domain d2zkdb_: 2zkd B: [154584]
    automated match to d2zkda1
    protein/DNA complex; complexed with act, edo

Details for d2zkdb_

PDB Entry: 2zkd (more details), 1.6 Å

PDB Description: crystal structure of the sra domain of mouse np95 in complex with hemi-methylated cpg dna
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d2zkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkdb_ b.122.1.12 (B:) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
sgmacvgrttectivpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgay
slvlaggyeddvdngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspine
kgaeaedwrqgkpvrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryl
lrrddtepepwtregkdrtrqlgltmqyp

SCOPe Domain Coordinates for d2zkdb_:

Click to download the PDB-style file with coordinates for d2zkdb_.
(The format of our PDB-style files is described here.)

Timeline for d2zkdb_: